PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10032941m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 163aa    MW: 18278.8 Da    PI: 9.739
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10032941mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-3269122255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+ave+LGG+++AtPk +l++m++kgL+++hvkSHLQ+YR 
  Ciclev10032941m  69 PRLRWTPELHLCFVQAVERLGGQDRATPKLVLQFMNIKGLSISHVKSHLQMYRN 122
                      8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.71465125IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-3065123IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1666123IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2469124IPR006447Myb domain, plants
PfamPF002492.0E-1070121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MKGSTDHSTS DHSKKTNHSN KIGTSDPNIY CKSIKGESSS NSSIEETVND QNKAASSGST  60
RQYNRSKTPR LRWTPELHLC FVQAVERLGG QDRATPKLVL QFMNIKGLSI SHVKSHLQMY  120
RNKKIDDPNQ GIFIYFLCHP SLLQILGFCL FLGLKDCHHT FI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435783.11e-119hypothetical protein CICLE_v10032941mg
TrEMBLA0A067FNE21e-119A0A067FNE2_CITSI; Uncharacterized protein
STRINGVIT_13s0067g01500.t011e-46(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.15e-43G2-like family protein